Deinococcus ficus: DFI_06180 Help Entry DFI_06180         CDS       T05674                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism dfc  Deinococcus ficus Pathway dfc03060   Protein export dfc03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:dfc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     DFI_06180  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     DFI_06180  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:dfc02044]     DFI_06180 Secretion system [BR:dfc02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    DFI_06180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ASN80642 UniProt:  A0A221SVH7 LinkDB All DBs Position 1254073..1254369 Genome browser AA seq 98 aa AA seqDB search MGNIGGPEILIILVAALLLFGPRRLPDLAKSAGQALRSFKQATSAVTDDLRAGLDPAAPA PGMAPTASTAAAVTPVAVTPVTVAPPAATAPAADPLRA NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgggcaacatcggtggaccggaaatcctgatcattctcgtggcggccctgctgctgttc gggcccaggcgcctgccggacctggcgaaaagcgccgggcaggccctgcgcagcttcaaa caggcgaccagcgccgtgaccgatgacctgcgcgccggcctggaccccgcggctcccgcg ccgggcatggcccccacggccagcacggctgcggccgtcacgccggtggccgtgactccc gtcaccgtggccccgccggcggccaccgccccggccgctgaccccctgcgcgcctga

DBGET integrated database retrieval system