Desulforamulus ferrireducens: B0537_01030 Help Entry B0537_01030       CDS       T04823                                  Name (GenBank) 4Fe-4S ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dfg  Desulforamulus ferrireducens Pathway dfg00020   Citrate cycle (TCA cycle) dfg00720   Other carbon fixation pathways dfg01100   Metabolic pathways dfg01110   Biosynthesis of secondary metabolites dfg01120   Microbial metabolism in diverse environments dfg01200   Carbon metabolism dfg01210   2-Oxocarboxylic acid metabolism Module dfg_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:dfg00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     B0537_01030   09102 Energy metabolism    00720 Other carbon fixation pathways     B0537_01030 Enzymes [BR:dfg01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      B0537_01030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_21 Fer4_9 Fer4_10 Fer4_16 Fer4_2 Fer4_8 Fer4_4 Fer4_17 Fer4_6 Fer4_22 Fer4_3 Fer4_13 Fer4_15 Fer4_18 Motif Other DBs NCBI-ProteinID:  AQS57810 UniProt:  A0A1S6ISR3 LinkDB All DBs Position 204625..204876 Genome browser AA seq 83 aa AA seqDB search MEFKGRTLELTKGHWTLFPGLCKGCGLCIQKCPKKCISWSKVLGVYGTPTVEANDECIAC GICQMVCPDTAIRVDKKKVAKEA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggaattcaaaggtcgtaccctggaacttaccaaaggtcactggactcttttccccggt ctgtgcaagggctgtggtctgtgcatccagaagtgccccaaaaaatgcatttcctggtcc aaggttctgggtgtctatggcacccctacggtagaagccaatgatgaatgcattgcctgc ggcatctgccagatggtttgccctgacacagccattcgggtggataagaagaaagtagcg aaggaagcctag

DBGET integrated database retrieval system