Desulforamulus ferrireducens: B0537_02025
Help
Entry
B0537_02025 CDS
T04823
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
dfg
Desulforamulus ferrireducens
Pathway
dfg03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
dfg00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
B0537_02025
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
dfg03011
]
B0537_02025
Ribosome [BR:
dfg03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
B0537_02025
Bacteria
B0537_02025
Archaea
B0537_02025
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID:
AQS57979
UniProt:
A0A1S6IT74
LinkDB
All DBs
Position
393612..393980
Genome browser
AA seq
122 aa
AA seq
DB search
MLIKPDRKAIRAKRRRRVRNKILGTAARPRLNVFRSLNNIYAQLINDEAGVTVVAASTLS
PELKGQLKNGCNIEAAKAVGNLIGKLAQEKGIKEVVFDRAGYLYHGRVKALADGAREAGL
DF
NT seq
369 nt
NT seq
+upstream
nt +downstream
nt
ttgcttatcaaacctgaccgtaaagcgatccgtgcaaaacgtcgtcgcagagtacggaat
aagattctgggcacagcggcaagaccacgtcttaacgttttccgcagcctaaacaacatt
tatgcccaacttatcaacgatgaagcaggcgtgaccgtggttgctgcttcaaccctatcg
ccggaattgaagggccaactaaagaatggttgcaatatcgaagctgctaaagctgttggt
aacttgatcggtaaattggctcaggagaagggtattaaagaagttgtatttgaccgcgct
ggttacctgtaccatggccgcgtgaaggccctggctgatggtgccagagaagcagggttg
gacttctag
DBGET
integrated database retrieval system