Desulforamulus ferrireducens: B0537_08305 Help Entry B0537_08305       CDS       T04823                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dfg  Desulforamulus ferrireducens Pathway dfg00020   Citrate cycle (TCA cycle) dfg00720   Other carbon fixation pathways dfg01100   Metabolic pathways dfg01110   Biosynthesis of secondary metabolites dfg01120   Microbial metabolism in diverse environments dfg01200   Carbon metabolism dfg01210   2-Oxocarboxylic acid metabolism Module dfg_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:dfg00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     B0537_08305   09102 Energy metabolism    00720 Other carbon fixation pathways     B0537_08305 Enzymes [BR:dfg01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      B0537_08305 SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_6 Fer4_2 Fer4_21 Fer4_7 Fer4_9 Fer4_16 Fer4_4 LdpA_Fe-S-bd Fer4_22 Fer4_3 Fer4_17 Fer4_13 DUF8105 Fer4_8 Motif Other DBs NCBI-ProteinID:  AQS59081 UniProt:  A0A1S6IWB9 LinkDB All DBs Position 1692544..1692771 Genome browser AA seq 75 aa AA seqDB search MTELSTVPGLPKTKVVINQSFCKKCGICIAFCNKAVLAAGEGNRIEVAQPEKCVGCGNCE NLCPDYAITLEVEEA NT seq 228 nt NT seq  +upstreamnt  +downstreamnt gtgacagaattatcaactgtacctggcttgcccaaaaccaaagtggtcattaatcagtct ttctgtaagaaatgtggtatctgtattgctttttgtaacaaagctgtactggctgctgga gaaggtaaccgaatagaggtggcacaaccggaaaaatgtgtaggttgtgggaactgcgaa aacctttgcccggattatgccatcactctggaggtggaagaagcatga

DBGET integrated database retrieval system