Desulfovibrio fairfieldensis: AXF13_03860 Help Entry AXF13_03860       CDS       T04293                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dfi  Desulfovibrio fairfieldensis Pathway dfi01100   Metabolic pathways dfi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dfi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AXF13_03860    00074 Mycolic acid biosynthesis     AXF13_03860   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AXF13_03860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Motif Other DBs NCBI-ProteinID:  AMD89314 UniProt:  A0A120KLT9 LinkDB All DBs Position complement(885758..885991) Genome browser AA seq 77 aa AA seqDB search MSDVAEKVTKIIVDQLGVSADEVKPEASFVEDLGADSLDLTELIMAMEEEFDIEIADDDA QKILKVQDAISYIENKK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtctgatgtcgcggaaaaagtaacaaaaatcattgtggaccaactgggcgtgagcgcc gatgaagtgaagcctgaagcctcctttgtggaagacctcggcgctgattccctggacctg accgaactgatcatggccatggaagaagagttcgacatcgaaatcgccgatgacgacgcc cagaaaattctcaaggtccaggacgccatttcctatattgaaaacaaaaaatag

DBGET integrated database retrieval system