Desulfovibrio fairfieldensis: AXF13_05790 Help Entry AXF13_05790       CDS       T04293                                  Name (GenBank) exodeoxyribonuclease VII   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism dfi  Desulfovibrio fairfieldensis Pathway dfi03430   Mismatch repair Brite KEGG Orthology (KO) [BR:dfi00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     AXF13_05790  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:dfi03400]     AXF13_05790 Enzymes [BR:dfi01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      AXF13_05790 DNA repair and recombination proteins [BR:dfi03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      AXF13_05790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S DUF2116 Motif Other DBs NCBI-ProteinID:  AMD89663 UniProt:  A0A0X8JIY8 LinkDB All DBs Position 1371577..1371840 Genome browser AA seq 87 aa AA seqDB search MSPKKENLFEKKMARLQEIVSALESGDLPLEEGMALYKEGAACSRFCREQLEKARHELSL WQDGELKSLNPDEVGSTARGQGPQEAE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagccccaagaaagaaaatcttttcgagaaaaaaatggcccgcttgcaggaaattgtc agcgccctggaatccggcgaccttccgctggaagagggcatggccctgtacaaggaaggc gcggcatgttcacgtttttgccgtgaacaattggaaaaagctcgccatgaactctccctc tggcaggacggcgagctgaaatctctgaatccggatgaggtagggagtacagcacgcggc caagggccgcaggaggcggaatag

DBGET integrated database retrieval system