Desulfovibrio fairfieldensis: AXF13_13905 Help Entry AXF13_13905       CDS       T04293                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism dfi  Desulfovibrio fairfieldensis Pathway dfi01100   Metabolic pathways dfi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dfi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AXF13_13905    00074 Mycolic acid biosynthesis     AXF13_13905   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AXF13_13905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  AMD91128 UniProt:  A0A109WA76 LinkDB All DBs Position 3312362..3312592 Genome browser AA seq 76 aa AA seqDB search MTRIQFFKELKEFLQCEADLTIDTCLWDLEEWDSMAIMSCIAYFDANFGVKTKFNQYKDV STVEDLMVLSKAVFED NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgacaagaatccagttttttaaagagctaaaagaatttttgcagtgtgaagcggacctc actattgatacttgcctgtgggatttggaagaatgggattcaatggccatcatgtcctgc attgcctacttcgatgcaaatttcggcgtaaaaacaaaattcaatcaatataaggatgtg tcaacagtggaggatctcatggtcctgagtaaagctgtatttgaagactga

DBGET integrated database retrieval system