Desulfovibrio ferrophilus: DFE_0178 Help Entry DFE_0178          CDS       T05829                                  Name (GenBank) 4Fe-4S ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dfl  Desulfovibrio ferrophilus Pathway dfl00020   Citrate cycle (TCA cycle) dfl00720   Other carbon fixation pathways dfl01100   Metabolic pathways dfl01110   Biosynthesis of secondary metabolites dfl01120   Microbial metabolism in diverse environments dfl01200   Carbon metabolism dfl01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dfl00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DFE_0178   09102 Energy metabolism    00720 Other carbon fixation pathways     DFE_0178 Enzymes [BR:dfl01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DFE_0178 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_21 Fer4_2 Fer4_10 Fer4_9 Fer4_4 Fer4_6 Fer4_8 Fer4_16 Fer4_17 LdpA_Fe-S-bd Fer4_22 Fer4_3 Fer4_ETF_QO Motif Other DBs NCBI-ProteinID:  BBD06904 UniProt:  A0A2Z6AUJ6 LinkDB All DBs Position complement(184194..184451) Genome browser AA seq 85 aa AA seqDB search MAKVQKGQTKITIYPDWCKGCGLCVAFCPGKVLELDPVEGCAKAIREEDCINCGFCELHC PDFAIVITPKDSKGSSEPNEGSKKS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcgaaagtacagaagggacaaacaaaaatcacaatctatccagactggtgcaaggga tgcgggctgtgtgtggccttttgccctggcaaggtcctggagcttgacccggtggaaggc tgtgccaaggccatccgggaagaggactgtatcaactgcggattctgcgaactccactgt ccggacttcgccattgtcatcacccccaaggacagcaaaggttcgagcgaacccaacgag gggagcaaaaaatcatga

DBGET integrated database retrieval system