Desulfovibrio ferrophilus: DFE_1407 Help Entry DFE_1407          CDS       T05829                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism dfl  Desulfovibrio ferrophilus Brite KEGG Orthology (KO) [BR:dfl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dfl03032]     DFE_1407    03036 Chromosome and associated proteins [BR:dfl03036]     DFE_1407    03400 DNA repair and recombination proteins [BR:dfl03400]     DFE_1407 DNA replication proteins [BR:dfl03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     DFE_1407 Chromosome and associated proteins [BR:dfl03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     DFE_1407 DNA repair and recombination proteins [BR:dfl03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       DFE_1407 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  BBD08133 UniProt:  A0A2Z6AY55 LinkDB All DBs Position complement(1512967..1513242) Genome browser AA seq 91 aa AA seqDB search MTKAGLVERIKDKAGLNTKVQAEMVLDTIVESARDALLEGDSAIFTGFGSFKVVQRAART GRNPGTGEMIRIPECKVVKYTMGKRVKGAIC NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgactaaagctggacttgtcgaaaggatcaaggacaaagctggcctgaacaccaaggtc caggccgagatggttttggatacgatcgtcgagtccgcccgtgatgctctgcttgaaggg gacagcgcaatctttaccggctttggatctttcaaggtcgttcagcgtgcagcccgcacc ggccggaatcccggtaccggtgagatgattcgtattcccgagtgtaaagtggtcaaatac accatggggaaacgggtcaaaggcgctatttgctag

DBGET integrated database retrieval system