Desulfovibrio ferrophilus: DFE_1780 Help Entry DFE_1780          CDS       T05829                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dfl  Desulfovibrio ferrophilus Pathway dfl00020   Citrate cycle (TCA cycle) dfl00720   Other carbon fixation pathways dfl01100   Metabolic pathways dfl01110   Biosynthesis of secondary metabolites dfl01120   Microbial metabolism in diverse environments dfl01200   Carbon metabolism dfl01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dfl00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DFE_1780   09102 Energy metabolism    00720 Other carbon fixation pathways     DFE_1780 Enzymes [BR:dfl01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DFE_1780 SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_9 Fer4_6 Fer4_10 Fer4_21 Fer4_16 Fer4_8 Fer4_4 Fer4_17 Fer4_20 Fer4_3 Fer4_18 Fer4_15 B3GALT2_N LdpA_Fe-S-bd Fer4_13 LAM_C RUBY_RBDX Motif Other DBs NCBI-ProteinID:  BBD08506 UniProt:  A0A2Z6AZC5 LinkDB All DBs Position complement(1901829..1902044) Genome browser AA seq 71 aa AA seqDB search MSEKRHIIDARRCKACGLCVDNCPKGVLAIGGKINAQGYNYVIQENPEKCVLCDICGMIC PDMAIGVVAEK NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagtgagaaaagacatatcattgatgcccgtcgctgtaaggcatgcggtctttgcgtg gacaattgtcctaagggcgttcttgctattggcggcaaaatcaatgctcaaggctacaat tacgtgattcaggaaaatcctgaaaaatgtgttctttgtgatatttgcggcatgatttgt cctgacatggccattggtgtcgtcgctgaaaaataa

DBGET integrated database retrieval system