KEGG   Desulfovibrio ferrophilus: DFE_2170
Entry
DFE_2170          CDS       T05829                                 
Name
(GenBank) ribonuclease III
  KO
K03685  ribonuclease III [EC:3.1.26.3]
Organism
dfl  Desulfovibrio ferrophilus
Brite
KEGG Orthology (KO) [BR:dfl00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    DFE_2170
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dfl03019]
    DFE_2170
   03009 Ribosome biogenesis [BR:dfl03009]
    DFE_2170
   03036 Chromosome and associated proteins [BR:dfl03036]
    DFE_2170
Enzymes [BR:dfl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     DFE_2170
Messenger RNA biogenesis [BR:dfl03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     DFE_2170
Ribosome biogenesis [BR:dfl03009]
 Eukaryotic type
  90S particles
   RNase
    DFE_2170
 Prokaryotic type
  rRNA processing factors
   DFE_2170
Chromosome and associated proteins [BR:dfl03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Microprocessor complex
     DFE_2170
SSDB
Motif
Pfam: Ribonucleas_3_3 Ribonuclease_3 dsrm RM44_endonuclase DND1_DSRM DSRM_2 Dicer_dimer
Other DBs
NCBI-ProteinID: BBD08896
UniProt: A0A2Z6B0H7
LinkDB
Position
2323309..2324022
AA seq 237 aa
MKQNFEALQQVISHRFSQVKLLHTALTHSSFANENPDQGGDNERLEYLGDAVLELCMSEI
LYRKFPEAPEGSLTRMRARLVSEPALADVARELGLSELLLLGKGEDSQGGRERNSLLSDA
LEAIFGAVFLDGGYAAAKLVVSTVFASRLPEMCDIRRSKDCKSSLQELTQERFKERPVYS
LKDSSGPEHAKVFKVEVALPEGTRISAQGQSMKQAEQNAAAKALNFFTKNDDQAPQT
NT seq 714 nt   +upstreamnt  +downstreamnt
atgaagcagaatttcgaggccttgcaacaagttatttcgcatcggttttctcaagtcaag
ctccttcacacagccttgacccacagttcgttcgccaatgagaaccccgatcagggcgga
gacaacgaacggctggagtatctcggagatgcggtgctggagctctgcatgtccgagata
ctctaccgcaaattccccgaagcccccgagggctcactcacgcgcatgcgcgctcggctt
gtcagtgagcccgcattggctgatgtcgcccgggaattgggattgagtgaattgctactt
ttgggaaagggggaagacagccaaggaggacgggaaagaaattccctgctgtccgatgcg
ctggaggcaatcttcggtgcggtatttctggacggaggatatgctgcagccaagctcgtg
gtgagcaccgtcttcgcatcccgattgcccgagatgtgcgacatccgccgctccaaggac
tgcaaaagcagcctgcaggaactgactcaggaacgcttcaaggaacgccccgtatactcg
ctgaaggacagcagtggcccggagcacgccaaggtattcaaggtggaagtggcgctgcct
gaaggcacccggatcagcgcccaaggacaaagcatgaagcaggccgagcagaacgctgca
gccaaggctctgaactttttcactaaaaacgacgatcaagcccctcagacttag

DBGET integrated database retrieval system