Desulfovibrio ferrophilus: DFE_2219 Help Entry DFE_2219          CDS       T05829                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dfl  Desulfovibrio ferrophilus Pathway dfl01100   Metabolic pathways dfl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dfl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DFE_2219    00074 Mycolic acid biosynthesis     DFE_2219   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DFE_2219 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  BBD08945 UniProt:  A0A2Z6B0G4 LinkDB All DBs Position 2374209..2374439 Genome browser AA seq 76 aa AA seqDB search MSTEAKIKDIIVDQLGVSADEVKNEASFVEDLGADSLDLTELIMAMEEEFGIEIDDDEAQ KLVKVQDAIDYIAKNN NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtccaccgaagccaaaatcaaagacatcatcgtcgaccagctcggcgtttccgctgac gaagtgaaaaacgaagcctcttttgtcgaagacctcggcgccgattccctggacctcacc gagctgatcatggctatggaagaggagttcggtatcgagatcgatgacgacgaagcccag aagctcgtcaaggtgcaggacgccatcgactatatcgccaagaacaactaa

DBGET integrated database retrieval system