Dolichospermum flos-aquae: HGD76_05960 Help Entry HGD76_05960       CDS       T06652                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dfs  Dolichospermum flos-aquae Pathway dfs00998   Biosynthesis of various antibiotics dfs01100   Metabolic pathways dfs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dfs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HGD76_05960 (acpP)    00074 Mycolic acid biosynthesis     HGD76_05960 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HGD76_05960 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QJB43824 UniProt:  A0A6H2BYI3 LinkDB All DBs Position 1188473..1188727 Genome browser AA seq 84 aa AA seqDB search MSQAVTFEKVKKIIVEQLSIEDADTVTPEASFVDDLGADSLDTVELVMALEEEFDIEIPD EAAEKIKTVQDTVDYISSHATASA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagccaagcagtaacttttgaaaaagttaaaaaaattatcgttgagcaacttagcata gaggatgcggatacggttacaccagaagccagttttgttgatgatttaggggctgattcc ctagatacagtggagttagttatggctttggaagaagaatttgatatcgaaattcctgat gaagcggctgaaaaaattaaaactgttcaagacactgtggattatatctctagtcacgct actgcatctgcatag

DBGET integrated database retrieval system