Megalodesulfovibrio gigas: DGI_1915 Help Entry DGI_1915          CDS       T02851                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism dgg  Megalodesulfovibrio gigas Pathway dgg01100   Metabolic pathways dgg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dgg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DGI_1915    00074 Mycolic acid biosynthesis     DGI_1915   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DGI_1915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AGW13695 UniProt:  T2GAU2 LinkDB All DBs Position complement(2031355..2031585) Genome browser AA seq 76 aa AA seqDB search MSVADKVKKIIVDQLGVSEDEVKPEAAFVEDLGADSLDLTELIMAMEEEFGIEIDDDDAQ KLLKVQDAIDYIGSKQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtccgtagccgataaagtcaaaaagatcatcgttgaccagcttggcgtctccgaagat gaagtcaaaccggaagctgccttcgtggaagacctcggcgccgactccctggacctgacc gagctgatcatggccatggaagaagaattcggcatcgaaatcgacgacgacgacgcccag aagctgctcaaggttcaggacgccatcgactacatcggaagcaagcaatag

DBGET integrated database retrieval system