Deinococcus gobiensis: DGo_CA2073 Help Entry DGo_CA2073        CDS       T01827                                  Symbol grxA Name (GenBank) Glutaredoxin-like protein, YruB   KO K18917   mycoredoxin [EC:1.20.4.3] Organism dgo  Deinococcus gobiensis Brite KEGG Orthology (KO) [BR:dgo00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     DGo_CA2073 (grxA) Enzymes [BR:dgo01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      DGo_CA2073 (grxA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Thioredoxin_2 Thioredoxin_9 GST_N Zn_ribbon_HMPTM IU_nuc_hydro Glrx-like Thioredoxin_3 TXD17-like_Trx Motif Other DBs NCBI-ProteinID:  AFD26000 UniProt:  H8GY72 LinkDB All DBs Position complement(2206058..2206303) Genome browser AA seq 81 aa AA seqDB search MIKMYTTSWCPDCHATKRALSSKGLAYEEINIEQDEQAAEYVMSVNGGRRSVPTLVSGDV AHSLSGFRPQKLDAFLAEAGL NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgatcaagatgtatacgacgagctggtgccccgactgccacgccacgaagcgtgccctg agcagcaagggcctggcctacgaggagatcaacatcgagcaggacgagcaggcggccgag tacgtgatgagcgtcaacgggggccgccgcagcgtgcccacgctggtgagcggcgacgtg gcccacagcctcagcggattccgtccccagaagctcgacgcgttcctggccgaagccggg ctgtga

DBGET integrated database retrieval system