Drosophila grimshawi: 6556642 Help Entry 6556642           CDS       T01061                                  Name (RefSeq) autophagy protein 12-like   KO K08336   ubiquitin-like protein ATG12 Organism dgr  Drosophila grimshawi Pathway dgr04068   FoxO signaling pathway dgr04136   Autophagy - other dgr04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:dgr00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     6556642  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     6556642    04136 Autophagy - other     6556642  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dgr04131]     6556642    04121 Ubiquitin system [BR:dgr04121]     6556642    03029 Mitochondrial biogenesis [BR:dgr03029]     6556642 Membrane trafficking [BR:dgr04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     6556642 Ubiquitin system [BR:dgr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    6556642 Mitochondrial biogenesis [BR:dgr03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     6556642 BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  6556642 NCBI-ProteinID:  XP_001983906 UniProt:  B4IWM8 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MTDTEEAQATASTSTTTTTPTEKDAAKICVLLNATGNVPIIKKRTWTVDPNKTVSWIQKF IHKFLKLDANEQIFLYVNQTFAPAPDQIIKNLYECHGTNGKLVLYYCKNQAWG NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgacggacacggaggaggcacaagcgaccgcttcaacgtcgaccacaaccacaacaccc accgaaaaggacgcagcgaaaatttgcgttttgctcaatgcaactggcaatgttccgatt attaaaaaacgtacttggaccgtggatcccaacaagactgttagctggatacaaaagttt atacacaaattcctcaagctggacgccaatgaacaaatttttctatatgtaaatcagact tttgcacctgcgccggatcagataattaaaaacctgtacgaatgccatggtacaaatggc aagttggttctctattactgcaagaatcaggcatggggctaa

DBGET integrated database retrieval system