Drosophila grimshawi: 6556711 Help Entry 6556711           CDS       T01061                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dgr  Drosophila grimshawi Pathway dgr04013   MAPK signaling pathway - fly dgr04145   Phagosome dgr04148   Efferocytosis dgr04310   Wnt signaling pathway dgr04620   Toll-like receptor signaling pathway dgr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dgr00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     6556711    04310 Wnt signaling pathway     6556711  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     6556711    04148 Efferocytosis     6556711  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     6556711  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     6556711  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dgr04131]     6556711   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dgr04147]     6556711    04031 GTP-binding proteins [BR:dgr04031]     6556711 Membrane trafficking [BR:dgr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     6556711  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     6556711   Macropinocytosis    Ras GTPases     6556711  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     6556711 Exosome [BR:dgr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    6556711   Exosomal proteins of other body fluids (saliva and urine)    6556711   Exosomal proteins of colorectal cancer cells    6556711   Exosomal proteins of bladder cancer cells    6556711 GTP-binding proteins [BR:dgr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     6556711 BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  6556711 NCBI-ProteinID:  XP_001983656 UniProt:  B4J2E5 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR DDKNTIEKLRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPV LQPKSKRKCTLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgattaaatgtgttgttgttggcgacggtgcagtgggtaaaacctgcctgctc atcagctatacgacaaatgcatttcccggcgaatatataccgaccgtattcgataattat tcggcaaatgtgatggtcgatgcgaaaccgattaatttgggtctgtgggatacggccgga caggaggattatgatcgtttgcgtccattgtcgtatccacagacggatgtcttcctcatc tgcttctcgctggtgaatccggcctcgtttgagaatgtgcgcgccaaatggtatccggag gtgcgtcatcattgtccgagcacaccgatcatccttgttggcaccaagttggatttgcgt gacgataagaacacgattgagaagctgcgcgacaagaagctggcacccatcacctatccc cagggtctggccatggccaaggagatcggtgctgtcaaatatttggagtgctcggcactg acgcaaaagggtctgaagaccgttttcgatgaggctatcagatcggttttgtgtcccgtt ctgcagcccaaatccaagcgtaaatgcacattgctctaa

DBGET integrated database retrieval system