Drosophila grimshawi: 6556711 Help Entry 6556711           CDS       T01061                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dgr  Drosophila grimshawi Pathway dgr04013   MAPK signaling pathway - fly dgr04145   Phagosome dgr04148   Efferocytosis dgr04310   Wnt signaling pathway dgr04517   IgSF CAM signaling dgr04518   Integrin signaling dgr04620   Toll-like receptor signaling pathway dgr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dgr00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     6556711    04310 Wnt signaling pathway     6556711   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     6556711    04518 Integrin signaling     6556711  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     6556711    04148 Efferocytosis     6556711  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     6556711  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     6556711  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dgr04131]     6556711   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dgr04147]     6556711    04031 GTP-binding proteins [BR:dgr04031]     6556711 Membrane trafficking [BR:dgr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     6556711  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     6556711   Macropinocytosis    Ras GTPases     6556711  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     6556711 Exosome [BR:dgr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    6556711   Exosomal proteins of other body fluids (saliva and urine)    6556711   Exosomal proteins of colorectal cancer cells    6556711   Exosomal proteins of bladder cancer cells    6556711 GTP-binding proteins [BR:dgr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     6556711 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  6556711 NCBI-ProteinID:  XP_001983656 UniProt:  B4J2E5 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR DDKNTIEKLRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPV LQPKSKRKCTLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgattaaatgtgttgttgttggcgacggtgcagtgggtaaaacctgcctgctc atcagctatacgacaaatgcatttcccggcgaatatataccgaccgtattcgataattat tcggcaaatgtgatggtcgatgcgaaaccgattaatttgggtctgtgggatacggccgga caggaggattatgatcgtttgcgtccattgtcgtatccacagacggatgtcttcctcatc tgcttctcgctggtgaatccggcctcgtttgagaatgtgcgcgccaaatggtatccggag gtgcgtcatcattgtccgagcacaccgatcatccttgttggcaccaagttggatttgcgt gacgataagaacacgattgagaagctgcgcgacaagaagctggcacccatcacctatccc cagggtctggccatggccaaggagatcggtgctgtcaaatatttggagtgctcggcactg acgcaaaagggtctgaagaccgttttcgatgaggctatcagatcggttttgtgtcccgtt ctgcagcccaaatccaagcgtaaatgcacattgctctaa

DBGET integrated database retrieval system