Drosophila grimshawi: 6557280 Help Entry 6557280           CDS       T01061                                  Name (RefSeq) ras-related protein Rac2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dgr  Drosophila grimshawi Pathway dgr04013   MAPK signaling pathway - fly dgr04145   Phagosome dgr04148   Efferocytosis dgr04310   Wnt signaling pathway dgr04517   IgSF CAM signaling dgr04518   Integrin signaling dgr04620   Toll-like receptor signaling pathway dgr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dgr00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     6557280    04310 Wnt signaling pathway     6557280   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     6557280    04518 Integrin signaling     6557280  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     6557280    04148 Efferocytosis     6557280  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     6557280  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     6557280  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dgr04131]     6557280   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dgr04147]     6557280    04031 GTP-binding proteins [BR:dgr04031]     6557280 Membrane trafficking [BR:dgr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     6557280  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     6557280   Macropinocytosis    Ras GTPases     6557280  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     6557280 Exosome [BR:dgr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    6557280   Exosomal proteins of other body fluids (saliva and urine)    6557280   Exosomal proteins of colorectal cancer cells    6557280   Exosomal proteins of bladder cancer cells    6557280 GTP-binding proteins [BR:dgr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     6557280 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  6557280 NCBI-ProteinID:  XP_001984698 UniProt:  B4J295 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCNNVPIILVGTKLDLR DDKPTIEKLKDKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPP SRRPHKRGCVLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcaatcaagtgtgttgttgttggcgacggagccgtgggtaaaacttgcctgctg atcagttatacgacaaatgcctttcccggcgaatatatacccaccgtattcgataattat tcggcaaatgtgatggtcgatgccaaaccgattaatttgggattatgggatacggccgga caggaggattacgatcgtttgcgtccattatcgtatccacaaacagatgtgttcctcatc tgtttctcgctggtgaatcccgcctcgtttgagaatgtgcgcgccaaatggtttcccgag gtgcgtcatcattgcaacaatgtgcccatcatcctcgtcggcaccaagctcgatttgcgc gatgataagccaacgattgagaaactcaaggataagaaactgacacccatcacctatccg caaggactggcaatggccaaggaaattgccgcggttaaatatctggaatgctcggctctc acacagaagggactgaagactgtcttcgatgaggcaatacgctcggtgctttgtccgccc agtcgtcggccgcacaagcgcggctgtgtcttgctctaa

DBGET integrated database retrieval system