Drosophila grimshawi: 6558539 Help Entry 6558539           CDS       T01061                                  Name (RefSeq) SKP1-like protein 11   KO K03094   S-phase kinase-associated protein 1 Organism dgr  Drosophila grimshawi Pathway dgr03083   Polycomb repressive complex dgr04120   Ubiquitin mediated proteolysis dgr04141   Protein processing in endoplasmic reticulum dgr04310   Wnt signaling pathway dgr04341   Hedgehog signaling pathway - fly dgr04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dgr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     6558539    04120 Ubiquitin mediated proteolysis     6558539   09126 Chromosome    03083 Polycomb repressive complex     6558539  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     6558539    04341 Hedgehog signaling pathway - fly     6558539    04350 TGF-beta signaling pathway     6558539  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dgr04131]     6558539    04121 Ubiquitin system [BR:dgr04121]     6558539    03036 Chromosome and associated proteins [BR:dgr03036]     6558539 Membrane trafficking [BR:dgr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     6558539 Ubiquitin system [BR:dgr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      6558539    Cul7 complex      6558539 Chromosome and associated proteins [BR:dgr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      6558539   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      6558539 BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  6558539 NCBI-ProteinID:  XP_001984378 UniProt:  B4IZV4 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MCHAPQSFQIRTSDDILFDVNFEVAQQIGLAESWLLHGLRESNSNSDICDANIVPLDRVS SHIFRLVLKWCQELLSQESTVDERNELQLRETLHRILTEANANDSMLFELIIAADYLNID ALLQTGTQYVADVITGCSTIEAIRERWHTMHHGAVEEETL NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtgccacgctccacagtcatttcaaatacgcaccagtgatgacatcctgttcgatgtc aactttgaagtcgcgcagcaaatcggattggcagaaagctggcttctacatggactcagg gagagcaacagcaacagcgatatatgcgatgccaatatagtgccattggacagagtaagc tcgcatatatttcgattggtgctgaagtggtgtcaagagctgctctcgcaggagagcact gtggatgagaggaatgagttgcagttacgtgaaacacttcatcggatcctcaccgaggcg aatgccaacgattcaatgctatttgaactgatcatcgcagccgactatctaaatattgat gcactcttacaaacaggtactcagtatgtggcggatgtgatcactggctgtagcactatt gaagcaattagggaacgttggcataccatgcaccatggcgcagttgaagaagaaaccctc taa

DBGET integrated database retrieval system