Drosophila grimshawi: 6561029 Help Entry 6561029           CDS       T01061                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism dgr  Drosophila grimshawi Brite KEGG Orthology (KO) [BR:dgr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:dgr03041]     6561029   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dgr04052]     6561029 Spliceosome [BR:dgr03041]  Complex B   Other components    Complex B specific factors     6561029 Cytokines and neuropeptides [BR:dgr04052]  Neuropeptides   Unclassified    6561029 BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  6561029 NCBI-ProteinID:  XP_001987148 UniProt:  B4J6T4 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEITCNDRLGKKVRVKCNPDDTVGDLKKLIAAQTGTKHEKIVLKKWYTIYKDPIRLSDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaaataacctgcaacgatcgtctgggcaaaaaggtgcgtgttaaatgcaatccc gacgacacagttggcgacctcaaaaaactgattgcggcgcagacgggcacaaaacacgag aagattgttctgaaaaaatggtacacaatttacaaggatccaattcgcctatctgattat gaaatccatgacggaatgaacttggagctgtattaccaataa

DBGET integrated database retrieval system