Drosophila grimshawi: 6561414 Help Entry 6561414           CDS       T01061                                  Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism dgr  Drosophila grimshawi Pathway dgr03030   DNA replication dgr03082   ATP-dependent chromatin remodeling dgr03410   Base excision repair dgr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:dgr00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     6561414    03410 Base excision repair     6561414    03420 Nucleotide excision repair     6561414   09126 Chromosome    03082 ATP-dependent chromatin remodeling     6561414  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dgr03032]     6561414    03036 Chromosome and associated proteins [BR:dgr03036]     6561414    03400 DNA repair and recombination proteins [BR:dgr03400]     6561414 Enzymes [BR:dgr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      6561414 DNA replication proteins [BR:dgr03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     6561414 Chromosome and associated proteins [BR:dgr03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     6561414 DNA repair and recombination proteins [BR:dgr03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       6561414 SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone Pim MVD-like_N Herpes_UL35 Motif Other DBs NCBI-GeneID:  6561414 NCBI-ProteinID:  XP_001988050 UniProt:  B4JBB2 LinkDB All DBs Position Unknown AA seq 135 aa AA seqDB search MVERIEDLNLPNAVIARLIKDALPDGSNVSKEARVAIAKAASVFVIFITSSSTALAHKQN HRTITAKDILQTLNELDFESFVPSLTQDLEAYRKMVKDKKESKANSKKDISTGDATASSS SAAAAAAADNEDANK NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggtcgaacgcatcgaagacttgaatttaccgaacgcagtgattgcccgcctgatcaag gatgctctgcccgatggctccaatgtcagcaaggaggcgcgtgttgcaattgcaaaggcc gcttctgtttttgtcatatttataacttcatcatcgacggcattggcacacaagcagaac cacaggaccattacggccaaggatattttgcagacgctcaacgaactggactttgagagc tttgtgccatcgctcactcaggacttggaggcgtacagaaagatggtgaaggataaaaaa gagagcaaggcaaacagcaaaaaggatatcagtactggagatgccacagcgagtagcagc tcagctgcagcagctgctgctgccgataatgaagacgccaataaataa

DBGET integrated database retrieval system