Drosophila grimshawi: 6563010 Help Entry 6563010           CDS       T01061                                  Name (RefSeq) ras-like protein 1   KO K07827   GTPase KRas Organism dgr  Drosophila grimshawi Pathway dgr04013   MAPK signaling pathway - fly dgr04068   FoxO signaling pathway dgr04137   Mitophagy - animal dgr04140   Autophagy - animal dgr04150   mTOR signaling pathway dgr04213   Longevity regulating pathway - multiple species dgr04214   Apoptosis - fly dgr04320   Dorso-ventral axis formation dgr04519   Cadherin signaling Brite KEGG Orthology (KO) [BR:dgr00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     6563010    04068 FoxO signaling pathway     6563010    04150 mTOR signaling pathway     6563010   09133 Signaling molecules and interaction    04519 Cadherin signaling     6563010  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     6563010    04137 Mitophagy - animal     6563010   09143 Cell growth and death    04214 Apoptosis - fly     6563010  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     6563010   09149 Aging    04213 Longevity regulating pathway - multiple species     6563010  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dgr04131]     6563010   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:dgr04031]     6563010 Membrane trafficking [BR:dgr04131]  Endocytosis   Macropinocytosis    Ras GTPases     6563010 GTP-binding proteins [BR:dgr04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     6563010 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Motif Other DBs NCBI-GeneID:  6563010 NCBI-ProteinID:  XP_001990517 UniProt:  B4JFU8 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL PSWNVQNEQAREVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDNKGRKGRKTNKP NRRFKCKML NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggaatacaagctagttgttgttggtgccggtggcgttggcaaatcagctctaacc atacaactaatccaaaatcatttcgttgatgaatacgatcccacaatcgaggactcatat cgaaagcaagtcgttattgatggtgagacgtgcttgctggatattcttgatactgccggc caagaagaatattccgccatgcgtgatcagtatatgcgaaccggtgagggttttcttctg gtgtttgccgtgaacagtgctaaatcctttgaagatattggcacatatcgcgagcaaatc aaacgtgtcaaggatgccgaagaggtgccgatggtgcttgtgggcaataaatgtgatctg ccatcgtggaacgtgcaaaacgagcaagcacgtgaggttgccaagcaatatggcattcca tacattgaaacatcagcgaagacgcgcatgggagttgatgatgcattttacacactggtg cgcgagatacgcaaggataaggataacaagggacgaaaaggacgcaaaacgaataagccg aatcgtagatttaaatgtaaaatgctttaa

DBGET integrated database retrieval system