Drosophila grimshawi: 6563247 Help Entry 6563247           CDS       T01061                                  Name (RefSeq) dynein light chain Tctex-type   KO K10420   dynein light chain Tctex-type 1/3 Organism dgr  Drosophila grimshawi Pathway dgr04145   Phagocytosis dgr04814   Motor proteins Brite KEGG Orthology (KO) [BR:dgr00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     6563247   09142 Cell motility    04814 Motor proteins     6563247  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dgr03037]     6563247    04812 Cytoskeleton proteins [BR:dgr04812]     6563247 Cilium and associated proteins [BR:dgr03037]  Motile cilia and associated proteins   Dynein arm    6563247 Cytoskeleton proteins [BR:dgr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      6563247 SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 MCEL_GT_NTPase DUF6547 Fascin Motif Other DBs NCBI-GeneID:  6563247 NCBI-ProteinID:  XP_001990252 UniProt:  B4JF33 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MDDSREESQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYK YIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggatgactcacgcgaggaaagtcaatttattgtggacgatgtgagtaaaacaattaaa gaggcaatcgaaacaacaatcggtggcaatgcgtaccagcacgacaaggtaaacaactgg accggccaggtggtcgaaaactgtctgactgtcctcaccaaggagcagaaaccatacaaa tacatcgtcaccgccatgattatgcagaagaatggtgctggactgcatacggccagctcc tgctattggaacaacgacaccgatggcagctgcaccgtgcgctgggagaataagaccatg tactgcattgtctccgtattcggtcttgctgtataa

DBGET integrated database retrieval system