Drosophila grimshawi: 6564863 Help Entry 6564863           CDS       T01061                                  Name (RefSeq) cdc42 homolog   KO K04393   cell division control protein 42 Organism dgr  Drosophila grimshawi Pathway dgr04144   Endocytosis dgr04517   IgSF CAM signaling dgr04518   Integrin signaling dgr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dgr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     6564863    04518 Integrin signaling     6564863  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     6564863  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     6564863  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dgr04131]     6564863    03036 Chromosome and associated proteins [BR:dgr03036]     6564863   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dgr04147]     6564863    04031 GTP-binding proteins [BR:dgr04031]     6564863 Membrane trafficking [BR:dgr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     6564863  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     6564863   Macropinocytosis    Ras GTPases     6564863 Chromosome and associated proteins [BR:dgr03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     6564863 Exosome [BR:dgr04147]  Exosomal proteins   Exosomal proteins of microglial cells    6564863   Exosomal proteins of breast milk    6564863 GTP-binding proteins [BR:dgr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     6564863 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  6564863 NCBI-ProteinID:  XP_001991103 UniProt:  B4JJH5 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLR DETSTLEKLAKNKQKPITSEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPP EPSKKRKCRFL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcaaaccatcaagtgcgtggtcgttggagatggagctgtgggcaagacgtgcctgctg atatcgtacacaaccaacaaatttccatcagaatatgtgccaactgtatttgacaactat gcggtgacagtgatgattggcggcgagccctatacgcttggattattcgatacggccggc caggaggattacgatcggctgcgtccgctctcatatccgcaaacggatgtgtttctcgtc tgcttctcggtggtcagccccagttcatttgagaatgttaaggagaagtgggtgccggaa ataacgcaccattgccaaaaaacgccgttcctgctggtgggcacacaaattgatttgcgc gacgagacaagcacattggagaagctggccaagaacaagcagaaacccattacatccgag cagggcgaaaagcttgccaaggagctgaaggcagtcaaatatgtggagtgctcggcacta acacagaagggcctgaaaaacgttttcgatgaggccattctggccgcactggagccgcca gagccatccaagaagaggaaatgcagattcctttaa

DBGET integrated database retrieval system