KEGG   Drosophila grimshawi: 6565352
Entry
6565352           CDS       T01061                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    6565352
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dgr00199]
    6565352
Enzymes [BR:dgr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     6565352
Cytochrome P450 [BR:dgr00199]
 Cytochrome P450, animal type
  CYP306 family
   6565352
SSDB
Other DBs
NCBI-GeneID: 6565352
NCBI-ProteinID: XP_001991189
FlyBase: FBgn0120008
UniProt: B4JJR1
LinkDB
Position
Unknown
AA seq 529 aa
MQAHTMDENRLDGSERMGLIVLGLLLGIIVAIVSLICQRRNARLFGRTPPGPWGLPLLGY
LPFLDRLAPHKSLQALAKRYGGIYQLKMGRVQTVVLSDATLVREFLRHEELTARAPLYLT
HGIMGGYGIIGAAGDIWKYQRRQLIEWLKALGMTRKQCETRAQLEQRISRGVNECVQSLE
TEAEQNDVLDPLPALQHTLGNIINDVVFGETYERNDPNWLYLQQLQEQGVKLIGVSGVVN
FLPWLRHLPGNQRCIRFLLDGKVKTHQLYDRIVNRCDERMERQLEQRQQEQRPPSEPHSI
LEHFLRERQPYSQLYCDEQLRHLLADLFGAGVDTALATLRWFLLYMAREQHCQKRLHADL
LKLSRTPTLAELEPLAYLRACLSEVQRIRSVVPLGIPHGVDQDITIGDYRLASGSMILVL
QWAIHMNPDAWPEPEQFRPERFLSDAGEYVAPAQFIPFQTGRRMCPGDELARMMLTLFAG
RILRRFHIQLDGDVSMDGECGITLAPAHFKLRFSQLELQRNPSKQQKHG
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgcaggcgcacactatggatgagaatcgtttggatggatctgaacggatgggcctgatc
gtgctgggcctcctgcttggcattatcgttgcaatcgtgtcgttgatttgccagcgccgg
aatgctcgtctctttggacgcacaccacccggtccgtggggcctgcccctgttgggctat
ttaccgttcctggaccggctggcgccgcataagtcactacaggcgctggccaaacgctat
ggcggcatctatcagctaaaaatgggccgggtgcaaacggtggtgctctcggatgcgaca
ctggtgcgtgagttccttcgtcacgaggagctgacggcacgagctccactctacttaacg
catggcattatgggtggctatggtatcattggagctgccggcgacatctggaaataccag
agacgacagcttatcgagtggctcaaggcgctgggcatgacgcgcaaacagtgcgaaacg
cgtgcgcagctggagcagcgcatcagtcgcggcgtcaacgaatgcgtccagtcacttgag
acggaagcagagcaaaacgatgtgctggatccgttgccggccttgcagcacacgctgggc
aacataatcaacgatgtggtctttggcgagacctatgagcgcaacgatcccaactggctg
tatctgcagcagctgcaggagcagggcgtcaagctgattggcgtctcgggagtggtgaac
tttttgccttggctgcgtcacctgccgggcaaccagcgctgcatacgctttctgctcgat
ggcaaggtcaagacgcatcagctctacgatcgaattgtcaatcgctgcgacgagcgaatg
gagagacagctggagcagcgacagcaagagcagcgaccaccatcggaaccgcatagcatt
ttggagcattttctgcgcgagcgacagccatattcgcagctctattgcgatgagcaactg
cgtcatctgctggccgatctctttggcgccggcgtcgatacagcgctggccacactgcgc
tggttcctgctctatatggcacgggagcagcactgccagaagcgactgcatgcggacctc
ctcaaattgagccggacaccaacgctggccgaactggagccgctggcatatctgcgcgcc
tgcctctcggaggtgcagcgcatccggtctgtagtgcctctgggcataccgcatggcgtc
gatcaggacatcaccattggcgattatcgtttggcgagcggtagcatgatactcgtactg
cagtgggccatacacatgaatccggatgcatggccagagccggaacagttccggccggag
cgtttcctcagcgacgccggtgagtatgtggcaccggcgcagtttatacctttccagacg
ggcaggcgcatgtgtccgggcgatgagttggcccgcatgatgctaacgcttttcgcgggc
cgcattctgcgccgcttccacatccagctggatggcgatgtgagcatggacggcgagtgt
ggcattactttggcgccggcacatttcaaactgcgcttcagccagctggagctgcagcgg
aatccttcgaagcagcagaaacacggttag

DBGET integrated database retrieval system