Dendronephthya gigantea (soft corals): 114518002 Help Entry 114518002         CDS       T06112                                  Name (RefSeq) centromere protein S-like   KO K11511   centromere protein S Organism dgt  Dendronephthya gigantea (soft corals) Pathway dgt03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:dgt00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     114518002  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dgt03036]     114518002    03400 DNA repair and recombination proteins [BR:dgt03400]     114518002 Chromosome and associated proteins [BR:dgt03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      114518002 DNA repair and recombination proteins [BR:dgt03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      114518002 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Histone Bromo_TP TFIID-31kDa TIP49_C RVT_1 UPF0122 LTV Motif Other DBs NCBI-GeneID:  114518002 NCBI-ProteinID:  XP_028393673 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MADSEDENFDEEYENLEHKQRLKAALHYTVGKICEEIGEETNLRYSKQFIAALTETTFKQ IGSFATDLELFAKHAKRTIINSDDVVLISRRSSVLNQHMKEISQELNEAHMIERANKKSK KAKKQKTLTVDENLEV NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctgacagtgaagatgaaaattttgatgaagagtatgagaatttggaacataaacag cgcttgaaagccgccctgcattacacagttggtaaaatatgcgaggaaatcggcgaagag acaaatttacgttattccaagcaattcatagctgctctaacagagacaacattcaaacaa ataggttcctttgcgacagatctggagctttttgcaaagcatgcaaaacggaccatcatt aattcagatgatgtggtgttaatcagtaggaggagttctgttctgaaccagcatatgaag gagataagtcaggaattaaatgaggcacacatgattgaacgagcaaacaagaaatccaag aaggccaagaaacaaaaaacattgacggtcgatgaaaatctggaggtataa

DBGET integrated database retrieval system