Dendronephthya gigantea (soft corals): 114531071 Help Entry 114531071         CDS       T06112                                  Name (RefSeq) glutathione S-transferase-like   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism dgt  Dendronephthya gigantea (soft corals) Pathway dgt00480   Glutathione metabolism dgt00980   Metabolism of xenobiotics by cytochrome P450 dgt00982   Drug metabolism - cytochrome P450 dgt00983   Drug metabolism - other enzymes dgt01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:dgt00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     114531071   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     114531071    00982 Drug metabolism - cytochrome P450     114531071    00983 Drug metabolism - other enzymes     114531071  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:dgt02000]     114531071 Enzymes [BR:dgt01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      114531071 Transporters [BR:dgt02000]  Other transporters   Pores ion channels [TC:1]    114531071 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_C_2 ARPP-1 NCAB1 Motif Other DBs NCBI-GeneID:  114531071 NCBI-ProteinID:  XP_028408515 LinkDB All DBs Position Unknown AA seq 135 aa AA seqDB search MVLATKRKANSYSLRAWHAIDTNAGHLEQKEETQPFIEYYKNKRLPKFLDFFETLLKENH KKTGKLVFVGDQLSWVDICAFHVIDGNLLECPEVLDREPTEYLKKFHSAIGERPNIKARL DSDKRPKYTHTGPIV NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggtacttgcgaccaagcgcaaagccaactcttacagtttacgggcgtggcacgctatc gatacgaacgcaggtcatctcgaacagaaagaagaaacgcagccttttattgaatattac aagaacaagcggcttccaaagtttctggattttttcgagactctcttgaaagaaaatcac aagaaaactggaaagctcgtgtttgttggcgaccagttgtcatgggttgacatttgcgca ttccatgttattgatgggaacctcctcgagtgtccagaggtgctggaccgagagcccacg gaatacctaaagaagtttcacagtgccataggagaaagaccaaatatcaaggcgaggctc gactccgacaaacgacccaaatacactcatactggacccattgtgtag

DBGET integrated database retrieval system