Dendronephthya gigantea (soft corals): 114533051 Help Entry 114533051         CDS       T06112                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism dgt  Dendronephthya gigantea (soft corals) Pathway dgt04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:dgt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     114533051  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dgt04121]     114533051    03400 DNA repair and recombination proteins [BR:dgt03400]     114533051 Ubiquitin system [BR:dgt04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      114533051    Cul5 complex      114533051 DNA repair and recombination proteins [BR:dgt03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      114533051 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 GcvP2_C Motif Other DBs NCBI-GeneID:  114533051 NCBI-ProteinID:  XP_028410435 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MEIFVMVRRAKLTMFLDCTESTTVSELKKMIEGIAKTAPEDQKLFKDEQALDDNKTLGDY GFTSQTARPQNPAMIGLACKVEGTDEWEALNITSLSTPPDPPDVMIPQESSATDAK NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaaatatttgtgatggttcgtcgcgcgaagctcaccatgtttctcgattgtaccgag tcaacaaccgtgtctgagctgaagaaaatgatcgagggcattgcaaagacagcgccagaa gatcagaaattgttcaaagatgaacaggctctcgacgataataaaacgctgggtgattac ggcttcacaagtcaaacagccagaccacaaaatcccgctatgattggtttggcctgcaaa gtggaaggcacagatgagtgggaggcattaaacatcacaagtctttcaacacctcctgat ccacctgatgtcatgattccgcaggaaagtagtgctaccgatgcaaaatga

DBGET integrated database retrieval system