KEGG   Drosophila hydei: 111596170
Entry
111596170         CDS       T05888                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dhe  Drosophila hydei
Pathway
dhe00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    111596170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dhe00199]
    111596170
Enzymes [BR:dhe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     111596170
Cytochrome P450 [BR:dhe00199]
 Cytochrome P450, animal type
  CYP306 family
   111596170
SSDB
Motif
Pfam: p450 BRCT_assoc
Other DBs
NCBI-GeneID: 111596170
NCBI-ProteinID: XP_023166031
UniProt: A0A6J1LML2
LinkDB
Position
Unknown
AA seq 509 aa
MSAAGDHLELIVFGLLLGIICLIVSLICHRRNARLLGRAPPGPWGLPLLGYLPFVDRLAP
HKSLQALAKRYGGIYQLSMGSVRTVVLSDAALVRDFLRHEELTARAPLYLTHGIMGGYGI
IGAGGDIWKYQRRQLIEWLKALGMTRKQCETRAQLEQRISCGVNECVQSYESEAKEAELL
DPLPALQHTLGNIINDLVFGETYERRDPNWLYLQQLQEQGVKLIGVSGMVNFLPWLRHLP
GNKRSIRFLLDGKAKTHALYDRIIGRCNQQLQQQQQQPKRSILAHFLHERQPYSQLYCDE
QLRHLLADLFGAGVDTSLATLRWFLLYMAREQRCQQRLQSELRSLSESPTLAELEPIAYL
RACLSEAQRIRSVVPLGIPHGVDQDTVVGDYHLKRGTMVLVLQWAIHMNPAVWPEPEQFR
PERFLNADGDYAAPAQFIPFQTGKRMCPGDELARMMLTLFAGRILRRFHIQLPAEEAQRV
DMQGECGITLAPAHYKLKFTHLEELPKNS
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgagtgctgcaggcgatcacctggaactgatcgtctttggactgctgctgggcattatc
tgcctgatagtttcgttgatttgccacaggcggaatgcacgtctgttggggcgcgccccg
ccgggaccttggggtctgccgctgcttggctatttgccattcgttgatcgcctggcgccg
cacaagtcgctgcaggcgctggccaagcgctacggcggcatctatcagctgagcatgggc
agcgtgcgcaccgtggtgctgtcggatgcggcgctggtgcgcgatttcctgagacacgag
gagctgacggcgcgtgcgccgctctacctgacgcacggcatcatgggcggctatggcatc
attggcgctggcggggacatctggaagtatcagcgaaggcagctcatcgagtggctcaaa
gcgttgggcatgacgcgcaaacagtgcgagacgcgtgcgcagctggagcagcgcatcagt
tgcggcgtcaatgagtgcgtccagtcgtacgagtcggaagcgaaggaagccgagctgctg
gatccgctgccagcgctgcagcacacgctgggcaacattatcaacgatctggtctttggc
gagacctatgagcgacgcgatcccaattggctgtatttgcagcagctgcaggagcagggc
gtcaagctgatcggcgtctcgggcatggttaactttttgccctggctgcgacatctgccg
ggcaacaagcgcagcatccgctttctgctggacggaaaggccaagacccatgcgctctac
gatcgcatcatcggacgctgcaaccagcagctgcagcagcagcagcagcagcccaagcgc
agcatattggcgcacttcttgcacgaacgtcagccgtactcgcagctttattgcgatgag
caactgcgccacctgttggccgatctcttcggcgctggcgtggacacatcgctggccacg
ctgcgctggtttctgttgtatatggcgcgtgagcagcgctgccagcagcgactgcagtcg
gagctgcggtcactcagcgagtcgcccacgctggccgagctcgagccgattgcctatctg
cgcgcctgcttgtccgaggcgcagcgcattcgctcggtcgtgccgctgggcataccgcat
ggcgtcgatcaggacacagtcgtgggtgactatcacttgaagaggggcaccatggtgctg
gtgctgcagtgggccatacacatgaatcccgccgtctggccggagccggagcagttccgt
ccggagcgcttcctcaacgctgatggcgactacgcggcaccggctcagttcatacccttt
cagacgggcaagcgcatgtgtcccggcgatgagctggcccgcatgatgctcacgctcttc
gctggccgcattctccgacgcttccacatccagctgcctgccgaagaggcgcagcgcgtg
gacatgcaaggcgaatgtggcatcaccttggccccggcgcactacaaactgaaatttacc
catctggaagagctgcccaagaattcatag

DBGET integrated database retrieval system