Drosophila hydei: 111598695 Help Entry 111598695         CDS       T05888                                  Name (RefSeq) probable insulin-like peptide 1   KO K04526   insulin Organism dhe  Drosophila hydei Pathway dhe04068   FoxO signaling pathway dhe04081   Hormone signaling dhe04140   Autophagy - animal dhe04150   mTOR signaling pathway dhe04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:dhe00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     111598695    04150 mTOR signaling pathway     111598695   09133 Signaling molecules and interaction    04081 Hormone signaling     111598695  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111598695  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     111598695  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dhe04052]     111598695 Cytokines and neuropeptides [BR:dhe04052]  Neuropeptides   Unclassified    111598695 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  111598695 NCBI-ProteinID:  XP_023169828 UniProt:  A0A6J1LQB7 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MAQLLRGGKHKLCGPALNEAMDVVCVNGYNTIPKKRFVAGDSPLEPDLESPSLEQSHQGF ALSPFLSSLYGTEVLIKTRRLRRQGGGIYDECCRNSCTRSELMAYCR NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcgcagctgctgcgcggcggcaagcacaagctgtgcggcccagcgctgaacgaggcc atggacgtggtctgcgtcaacggctacaatacgataccgaagaagcgttttgtggccggc gactcgccgctggagccagatctcgagtcgccctcgctggagcagtcgcatcagggcttt gcgctgagtcccttcctctccagcctctatggcaccgaggtgctgatcaagacgcgacgt ctgcggcgccaaggcggcggcatctatgacgaatgctgtcgcaactcctgcacccgctcg gagctgatggcctactgtcgctag

DBGET integrated database retrieval system