Drosophila hydei: 111600634 Help Entry 111600634         CDS       T05888                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism dhe  Drosophila hydei Pathway dhe04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:dhe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     111600634  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dhe04121]     111600634    03400 DNA repair and recombination proteins [BR:dhe03400]     111600634 Ubiquitin system [BR:dhe04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      111600634    Cul5 complex      111600634 DNA repair and recombination proteins [BR:dhe03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      111600634 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD GABP-alpha Motif Other DBs NCBI-GeneID:  111600634 NCBI-ProteinID:  XP_023172607 UniProt:  A0A6J1M6V4 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKENTSVIELKRMIEGILKVLPSDQRLFNQDNDVMEDDQTLQD YGVTVSTAKAQAPAQLGLICRNESGDFETLDITPYSAPPDLPEVMKNQEASNGQEQVA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcctcatgatcagaaggcataagacaaccatctttacggatgctaaggaa aacacatcagttattgaactgaaacgcatgatcgaaggcattttgaaagtgttgcctagc gatcagcggttattcaatcaggacaacgacgtcatggaggatgatcaaacgttgcaggac tacggcgttacggtatcaacagcaaaggctcaagccccagcacaattgggcctaatatgc aggaacgaatcgggcgatttcgagacgctggatatcacgccctattcagcaccgcctgac ttaccagaagtgatgaaaaatcaagaggcctcaaatggacaagaacaagtggcataa

DBGET integrated database retrieval system