Drosophila hydei: 111601874 Help Entry 111601874         CDS       T05888                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism dhe  Drosophila hydei Brite KEGG Orthology (KO) [BR:dhe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:dhe03041]     111601874   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dhe04052]     111601874 Spliceosome [BR:dhe03041]  Complex B   Other components    Complex B specific factors     111601874 Cytokines and neuropeptides [BR:dhe04052]  Neuropeptides   Unclassified    111601874 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Rad60-SLD OTU1_UBXL PI3K_rbd Motif Other DBs NCBI-GeneID:  111601874 NCBI-ProteinID:  XP_023174520 UniProt:  A0A6J1M7Y2 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTIYKDPIRLSDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaaataacttgcaatgatcgtttgggcaaaaaggtgcgtgtgaagtgcaacccc gacgatacaattggcgaccttaaaaaattaatagcggcacaaactggcacgaaacatgag aagatcgtgctgaaaaagtggtatactatctacaaggatcccattcgtctatcagattat gaaattcacgacggcatgaatctggagctctactaccaatag

DBGET integrated database retrieval system