Drosophila hydei: 111602902 Help Entry 111602902         CDS       T05888                                  Name (RefSeq) ras-related protein Rac2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dhe  Drosophila hydei Pathway dhe04013   MAPK signaling pathway - fly dhe04145   Phagosome dhe04148   Efferocytosis dhe04310   Wnt signaling pathway dhe04620   Toll-like receptor signaling pathway dhe05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dhe00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     111602902    04310 Wnt signaling pathway     111602902  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     111602902    04148 Efferocytosis     111602902  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111602902  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     111602902  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dhe04131]     111602902   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dhe04147]     111602902    04031 GTP-binding proteins [BR:dhe04031]     111602902 Membrane trafficking [BR:dhe04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     111602902  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     111602902   Macropinocytosis    Ras GTPases     111602902  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     111602902 Exosome [BR:dhe04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111602902   Exosomal proteins of other body fluids (saliva and urine)    111602902   Exosomal proteins of colorectal cancer cells    111602902   Exosomal proteins of bladder cancer cells    111602902 GTP-binding proteins [BR:dhe04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     111602902 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD RsgA_GTPase Motif Other DBs NCBI-GeneID:  111602902 NCBI-ProteinID:  XP_023176008 UniProt:  A0A6J1M9R8 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCNNVPIILVGTKLDLR DDKQTIEKLKDKKLTPITYPQGLAMAKEISAVKYLECSALTQKGLKTVFDEAIRSVLCPP IGKPNNRKCILL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagcaatcaaatgtgttgttgttggcgacggcgccgtgggcaagacctgcctgctg atcagctatacaacgaacgccttccccggcgaatatataccaacagtattcgataactat tctgcgaatgtgatggtcgatgccaaaccgattaatctcggtctatgggatacggccggg caggaagattacgatagactgcgacctttgtcctatccacagacggacgtatttctcatt tgcttctcgctggtgaaccccgcctcctttgagaacgtacgcgccaaatggtttcccgag gtgcgtcatcattgcaacaatgtgccgattattctcgtcggcacgaagctcgatctgcgc gacgataaacagacaattgagaaactgaaggataagaagctgacgcccattacctatccg cagggcttagccatggccaaggaaatttcagcggttaaatatttagagtgctctgctcta acacaaaagggtctgaaaacggtattcgatgaggccatacgctccgtcctatgcccaccg ataggcaaaccaaacaatcggaagtgcatacttctctaa

DBGET integrated database retrieval system