Drosophila hydei: 111605450 Help Entry 111605450         CDS       T05888                                  Name (RefSeq) dynein light chain Tctex-type   KO K10420   dynein light chain Tctex-type 1/3 Organism dhe  Drosophila hydei Pathway dhe04814   Motor proteins Brite KEGG Orthology (KO) [BR:dhe00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     111605450  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dhe03037]     111605450    04812 Cytoskeleton proteins [BR:dhe04812]     111605450 Cilium and associated proteins [BR:dhe03037]  Motile cilia and associated proteins   Dynein arm    111605450 Cytoskeleton proteins [BR:dhe04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      111605450 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 DUF6547 Fascin Motif Other DBs NCBI-GeneID:  111605450 NCBI-ProteinID:  XP_023179734 UniProt:  A0A6J2SV29 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MDDSREESQFIVDDVSKTIKEAIESTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYK YIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggatgactcacgcgaggaaagccaatttattgtggatgatgtgagcaaaacaattaaa gaggctatcgaatcaactatcggtggcaacgcataccagcacgataaagtaaacaactgg accggccaggtggtcgaaaattgcctcactgtgctcaccaaagagcagaagccctacaaa tacattgtcacagccatgatcatgcaaaagaacggcgccggactgcacacggccagctcc tgctactggaataacgacaccgacggcagctgcaccgtccgctgggaaaataagaccatg tactgcatcgtctcggtctttgggctggccgtttag

DBGET integrated database retrieval system