Dolichospermum heterosporum: NG743_10340 Help Entry NG743_10340       CDS       T08533                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dht  Dolichospermum heterosporum Pathway dht00998   Biosynthesis of various antibiotics dht01100   Metabolic pathways dht01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dht00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NG743_10340 (acpP)    00074 Mycolic acid biosynthesis     NG743_10340 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NG743_10340 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF6137 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UUO17342 UniProt:  A0ABY5M2S2 LinkDB All DBs Position 2342041..2342295 Genome browser AA seq 84 aa AA seqDB search MSQADIFEKVKAIIVEQLSVEDEAKVTLQASFVDDLGADSLDTVELVMALEEEFDIEIPD EAAEKILTVQHVIDYINNHVAASA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagccaagcagatatttttgaaaaggttaaagcaattatcgttgagcaacttagtgta gaagatgaggctaaggttacactacaagccagttttgttgatgatttaggggctgattcc ctagatacagttgaattggtaatggctttggaagaagaatttgatatcgaaattcctgat gaagcggctgaaaaaattctcactgttcaacacgttatagattatataaataatcacgtt gctgcatctgcatag

DBGET integrated database retrieval system