Dolichospermum heterosporum: NG743_12220 Help Entry NG743_12220       CDS       T08533                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism dht  Dolichospermum heterosporum Pathway dht00190   Oxidative phosphorylation dht00195   Photosynthesis dht01100   Metabolic pathways Module dht_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:dht00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     NG743_12220 (atpE)    00195 Photosynthesis     NG743_12220 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:dht00194]     NG743_12220 (atpE) Photosynthesis proteins [BR:dht00194]  Photosystem and electron transport system   F-type ATPase [OT]    NG743_12220 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  UUO17678 LinkDB All DBs Position 2718842..2719087 Genome browser AA seq 81 aa AA seqDB search MDPLVQAASVLAAALAIGLAAIGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLTLAFM ESLTIYGLVIALVLLFANPFA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggatccattagtacaagctgcctcagttctagctgctgctctcgctatcggtttagct gcaattggacctggtattggtcaaggtaatgcagcaggtcaagccgtagaaggtattgcc cgtcagcccgaagcagaaggcaaaattcgcggcacactacttttaaccttagccttcatg gaatccttgacaatttacggtttggtaattgccttggtattgctattcgctaaccctttt gcctaa

DBGET integrated database retrieval system