Maridesulfovibrio hydrothermalis: DESAM_20243 Help Entry DESAM_20243       CDS       T02428                                  Symbol acpA Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dhy  Maridesulfovibrio hydrothermalis Pathway dhy00998   Biosynthesis of various antibiotics dhy01100   Metabolic pathways dhy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dhy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DESAM_20243 (acpA)    00074 Mycolic acid biosynthesis     DESAM_20243 (acpA)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DESAM_20243 (acpA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB Ribosomal_L12_N PP-binding_2 WGG Motif Other DBs NCBI-ProteinID:  CCO22534 UniProt:  L0R718 LinkDB All DBs Position 556577..556807 Genome browser AA seq 76 aa AA seqDB search MSAAEKVKAIIIDQLGVSADEIKDEASFVEDLGADSLDLTELIMAMEEEFDVEIEDEDAQ KIMKVKDAIAFVENKQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtccgcagctgaaaaagtaaaagcaattatcatagaccagcttggtgtatccgcagac gaaattaaagatgaagcttccttcgtcgaagatctcggtgctgactctctcgaccttaca gaactcatcatggctatggaagaagagttcgacgtagaaatcgaagatgaagatgctcag aaaattatgaaagtaaaggatgcaatcgcattcgttgaaaacaagcagtag

DBGET integrated database retrieval system