Maridesulfovibrio hydrothermalis: DESAM_20930 Help Entry DESAM_20930       CDS       T02428                                  Name (GenBank) putative Acyl carrier protein   KO K02078   acyl carrier protein Organism dhy  Maridesulfovibrio hydrothermalis Pathway dhy00998   Biosynthesis of various antibiotics dhy01100   Metabolic pathways dhy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dhy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DESAM_20930    00074 Mycolic acid biosynthesis     DESAM_20930   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DESAM_20930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  CCO23217 UniProt:  L0RAH6 LinkDB All DBs Position complement(1266276..1266491) Genome browser AA seq 71 aa AA seqDB search MKDIIIDTLGKYISLDSSFDTSTQFVNIDGWDSLKHVQFILDLEKELDIKLTPEQLIACT SVDVIIQVVDK NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgaaagatatcattattgacacacttggaaaatatatttccttagactcttcttttgac acaagcacacagtttgtaaatattgatggctgggactcactaaaacatgttcagttcatt ttggaccttgaaaaagaactagacataaaacttacacccgagcagcttatagcttgtact tcagttgatgtaataatccaagtagttgacaaataa

DBGET integrated database retrieval system