Maridesulfovibrio hydrothermalis: DESAM_22241
Help
Entry
DESAM_22241 CDS
T02428
Symbol
clpS
Name
(GenBank) ATP-dependent Clp protease adapter protein ClpS
KO
K06891
ATP-dependent Clp protease adaptor protein ClpS
Organism
dhy
Maridesulfovibrio hydrothermalis
Brite
KEGG Orthology (KO) [BR:
dhy00001
]
09190 Not Included in Pathway or Brite
09192 Unclassified: genetic information processing
99975 Protein processing
DESAM_22241 (clpS)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ClpS
Motif
Other DBs
NCBI-ProteinID:
CCO24508
UniProt:
L0RCJ5
LinkDB
All DBs
Position
2639567..2639875
Genome browser
AA seq
102 aa
AA seq
DB search
MPEYIEEFESDVLFENELKEPRKFRVLLHNDDYTSMEFVIAVLIQVFRKTEEESTEIMLK
VHNDGVGVCGVYTAEIAETRVEMVRQLAQQAGYPLKCTIEEV
NT seq
309 nt
NT seq
+upstream
nt +downstream
nt
atgcctgaatacatagaagaatttgaatcagatgtgttgtttgagaacgaattgaaagag
cctcggaaatttcgggtgcttttgcataatgatgattacacttccatggaattcgtcata
gctgtgctcatacaggtttttagaaaaactgaagaggaatccacagagatcatgctcaag
gtccataatgacggggtcggagtttgtggagtttatacagccgaaattgctgaaacacgc
gttgaaatggtaaggcagcttgcgcagcaagcgggctatccgctgaaatgcacaatcgaa
gaggtctag
DBGET
integrated database retrieval system