Maridesulfovibrio hydrothermalis: DESAM_22500 Help Entry DESAM_22500       CDS       T02428                                  Symbol atpE Name (GenBank) ATP synthase subunit c 2   KO K02110   F-type H+-transporting ATPase subunit c Organism dhy  Maridesulfovibrio hydrothermalis Pathway dhy00190   Oxidative phosphorylation dhy01100   Metabolic pathways Module dhy_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:dhy00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     DESAM_22500 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:dhy00194]     DESAM_22500 (atpE) Photosynthesis proteins [BR:dhy00194]  Photosystem and electron transport system   F-type ATPase [OT]    DESAM_22500 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF5714 Rv2632c-like Motif Other DBs NCBI-ProteinID:  CCO24767 UniProt:  L0REY1 LinkDB All DBs Position complement(2908289..2908567) Genome browser AA seq 92 aa AA seqDB search METLGWIAFASIIAAGLCMGIGAIGPAIGEGMALSRALSSIAQQPDETNTIVKFLFVGMA MVESTAIYCFVLAMILLFANPFWAYFLEKAGG NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggaaactcttggctggattgcatttgcatccattattgcagctggtctttgtatgggc atcggggctatcgggccggctataggtgaaggaatggctttgtcgcgggcgcttagttcc attgcccagcagcctgatgaaaccaatactattgtaaagtttttgttcgtagggatggcg atggttgaatctaccgctatttattgttttgttctggccatgattttactttttgccaat ccattttgggcctactttttagagaaggccgggggctga

DBGET integrated database retrieval system