Dickeya poaceiphila: Dpoa569_0001443 Help Entry Dpoa569_0001443   CDS       T06188                                  Symbol flgM Name (GenBank) anti-sigma-28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism dic  Dickeya poaceiphila Pathway dic02020   Two-component system dic02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:dic00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Dpoa569_0001443 (flgM)  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Dpoa569_0001443 (flgM)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:dic02035]     Dpoa569_0001443 (flgM) Bacterial motility proteins [BR:dic02035]  Flagellar system   Flagellar assembly proteins    Others     Dpoa569_0001443 (flgM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  QDX29642 UniProt:  A0A5B8I3E5 LinkDB All DBs Position complement(1580294..1580593) Genome browser AA seq 99 aa AA seqDB search MSIDRTQSVNPVNPAQSWDTGDVSKLKRKEETGQQSGVAGTQVKLSDAQSKLMQPSSQDI DIQRVETLKQAIRNGSLKMNVGKIADALLKDAQDLVSGD NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgagcattgatcggacccaatcagtcaatccagtaaacccagctcaatcctgggatact ggcgatgtgagcaaattaaaacgcaaagaagaaaccgggcaacagagcggtgtggctggc actcaggttaaactgagtgatgctcagtccaaactgatgcaaccgtcatctcaggatatc gatatccaacgcgtagaaacgctgaagcaggctattcgtaacggttcattgaaaatgaac gttggtaaaattgctgatgcattgcttaaagatgcacaggacttggtttcaggcgattaa

DBGET integrated database retrieval system