KEGG   Dietzia sp. DQ12-45-1b: GJR88_03462
Entry
GJR88_03462       CDS       T11395                                 
Name
(GenBank) heat shock protein Hsp20 family protein
  KO
K13993  HSP20 family protein
Organism
did  Dietzia sp. DQ12-45-1b
Pathway
did04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:did00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    GJR88_03462
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:did03110]
    GJR88_03462
Chaperones and folding catalysts [BR:did03110]
 Heat shock proteins
  HSP20
   GJR88_03462
SSDB
Other DBs
NCBI-ProteinID: QGW25276
LinkDB
Position
complement(2388542..2388976)
AA seq 144 aa
MADNLARFDPFAGLDALRREFLDSGLLGTLRGRAPTTDVYTEGDTGLVVEVHLPNFEEKD
ISVAVDKGTLSIQAERHERDEDKSRKYVVRESSSSFFRSIALPDHADVQKITADYDDGVL
KVTVPLAEISAPTKIQIGSGGSAP
NT seq 435 nt   +upstreamnt  +downstreamnt
atggcggacaacctggcacgattcgatccgttcgcggggctcgacgccctgcggagggag
ttcctggacagcggtctgttgggcaccctccgcggcagggccccgaccaccgacgtgtac
accgagggggacacggggttggtggtggaggtccatctcccgaacttcgaggagaaggac
atctccgtcgccgtcgacaaggggacgctgtccatccaggccgagcggcacgagcgcgac
gaggacaagtcgcgcaagtacgtcgtccgcgagagcagcagcagcttcttccgcagcatc
gcgttgcccgatcacgccgatgtccagaagatcacggccgactacgacgacggtgtcctc
aaggtcaccgtccccctggcggagatctccgcgccgacgaagatccagatcgggtccggt
ggcagcgcgccgtaa

DBGET integrated database retrieval system