Diaphorobacter sp. HDW4A: G7047_02795 Help Entry G7047_02795       CDS       T06499                                  Name (GenBank) hypothetical protein   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism dih  Diaphorobacter sp. HDW4A Pathway dih03010   Ribosome Brite KEGG Orthology (KO) [BR:dih00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     G7047_02795   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     G7047_02795  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:dih03011]     G7047_02795    04121 Ubiquitin system [BR:dih04121]     G7047_02795   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dih04147]     G7047_02795 Ribosome [BR:dih03011]  Ribosomal proteins   Eukaryotes    Small subunit     G7047_02795   Archaea     G7047_02795 Ubiquitin system [BR:dih04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    G7047_02795 Exosome [BR:dih04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    G7047_02795   Exosomal proteins of colorectal cancer cells    G7047_02795 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_ribbon_TiaS Zn_ribbon_8 DUF7128 Lar_restr_allev zf-H2C2_2 zf-C2H2_4 eIF-5_eIF-2B zf-C2H2 Motif Other DBs NCBI-ProteinID:  QIL78967 UniProt:  A0A6G8CJQ6 LinkDB All DBs Position complement(647305..647496) Genome browser AA seq 63 aa AA seqDB search MGTRRPPTCPLCQGPGIALGSLGRLHWYRCRHCGMDFSRAARPKKPHTPAVQPARPTIQE HQA NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgggcacgagaagacccccgacctgcccgctgtgccaggggccaggcattgccctcggc agccttggccgcctgcactggtaccgctgtcgccactgcggcatggatttcagccgggct gcacgcccgaagaagccgcacacgcccgccgttcaaccggcacgcccaaccatccaggag catcaagcatga

DBGET integrated database retrieval system