Diaphorobacter sp. HDW4A: G7047_21940 Help Entry G7047_21940       CDS       T06499                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism dih  Diaphorobacter sp. HDW4A Brite KEGG Orthology (KO) [BR:dih00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:dih03110]     G7047_21940 (grxC) Chaperones and folding catalysts [BR:dih03110]  Protein folding catalysts   Protein disulfide isomerase    G7047_21940 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR Thioredoxin_2 CLIC-like_N Lar_restr_allev Thioredoxin_3 Thioredoxin Tox-PL-2 Motif Other DBs NCBI-ProteinID:  QIL82297 UniProt:  A0A6G8CUA4 LinkDB All DBs Position complement(4778134..4778406) Genome browser AA seq 90 aa AA seqDB search MKPDVLLYTTSWCPFCRRAKTLLKEKGVKWKELDIEADRDHRQAMTQASGRNTVPQIFIN GTHVGGFDDLFELDAKGMLDKLLDRSPPAN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaacctgatgtcctcctatacacaacgagctggtgcccgttttgccgacgggcgaag acgctcctcaaggaaaaaggggtgaaatggaaagagctcgatatcgaggcagaccgcgat caccgccaggccatgacgcaagcgtcgggtcgaaacaccgtgccgcagatattcatcaac ggcacgcatgtcggtggtttcgacgaccttttcgagctcgatgctaaaggcatgctcgac aaactgctagatcgtagtccgcctgcgaattga

DBGET integrated database retrieval system