Diaphorobacter sp. HDW4A: G7047_30215 Help Entry G7047_30215       CDS       T06499                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism dih  Diaphorobacter sp. HDW4A Brite KEGG Orthology (KO) [BR:dih00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dih03032]     G7047_30215    03036 Chromosome and associated proteins [BR:dih03036]     G7047_30215    03400 DNA repair and recombination proteins [BR:dih03400]     G7047_30215 DNA replication proteins [BR:dih03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     G7047_30215 Chromosome and associated proteins [BR:dih03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     G7047_30215 DNA repair and recombination proteins [BR:dih03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       G7047_30215 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_1 HU-CCDC81_bac_2 DUF397 Motif Other DBs NCBI-ProteinID:  QIL84298 UniProt:  A0A6G8CZN7 LinkDB All DBs Position p_unnamed1:complement(151269..151571) Genome browser AA seq 100 aa AA seqDB search MNRAELVEILASKNDLSKSAANGVLETLIETIQTAVKKGDAVQLVGFGTFKSVKRAARTG KNPATGAALKIPATTVPKFVAGAKFKAVVDPKAAKRKAAK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaaccgtgctgaactcgtagaaatcctggcttccaaaaacgatctgtccaagagcgct gccaacggcgtgctggagacgctgatcgagaccattcagaccgccgtcaaaaaaggcgat gcagtccagctggtgggttttggaaccttcaagtcggtcaagcgcgcggcccgcaccggc aagaacccagccacgggtgcggccctcaagattcccgccaccaccgtgcccaagttcgtg gccggtgccaagttcaaagccgtggtggaccccaaggctgccaagcgcaaggcagcgaag taa

DBGET integrated database retrieval system