Diaphorobacter sp. MNS-0: K2L43_01210 Help Entry K2L43_01210       CDS       T10618                                  Name (GenBank) phenol hydroxylase subunit   KO K16249   phenol/toluene 2-monooxygenase (NADH) P0/A0 Organism dim  Diaphorobacter sp. MNS-0 Pathway dim00361   Chlorocyclohexane and chlorobenzene degradation dim00362   Benzoate degradation dim00623   Toluene degradation dim01100   Metabolic pathways dim01120   Microbial metabolism in diverse environments dim01220   Degradation of aromatic compounds Module dim_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:dim00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     K2L43_01210    00361 Chlorocyclohexane and chlorobenzene degradation     K2L43_01210    00623 Toluene degradation     K2L43_01210 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Phenol_hyd_sub Motif Other DBs NCBI-ProteinID:  QYY25832 LinkDB All DBs Position 267392..267607 Genome browser AA seq 71 aa AA seqDB search MTCTATEAPATTPQPVCDLSQRFVRVLGRRDNGLVEFSFSIGWPELSVELMLPAPAFEAF CAAHRVRHLDD NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgacctgcactgccaccgaggcgcccgccaccaccccgcaacccgtctgcgatctgtcg cagcggttcgttcgcgtgctgggccgccgcgacaacggccttgtcgagttttcgttctcg atcggatggcctgagctgtcggtggagctgatgctccccgcaccggcattcgaggccttt tgcgcggcgcaccgcgtgcgccacctggatgactga

DBGET integrated database retrieval system