Diaphorobacter sp. MNS-0: K2L43_14105 Help Entry K2L43_14105       CDS       T10618                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dim  Diaphorobacter sp. MNS-0 Pathway dim01100   Metabolic pathways dim01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dim00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K2L43_14105 (acpP)    00074 Mycolic acid biosynthesis     K2L43_14105 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K2L43_14105 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  QYY24811 LinkDB All DBs Position complement(2949379..2949618) Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYANTHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaaaaaaatcattgccgaacaactcggcgtggaagaa tcccaagtcaccaacgaaaaagccttcgtggcagatctgggtgccgactcgctggacacg gtggaactggtgatggcgctggaagacgagttcggcatcgagatccctgacgaagacgca gagaagatcacgacggtgcaaaacgccatcgactacgccaatacccaccagaaggcctaa

DBGET integrated database retrieval system