Desulfurispirillum indicum: Selin_0579 Help Entry Selin_0579        CDS       T01383                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism din  Desulfurispirillum indicum Pathway din01100   Metabolic pathways din01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:din00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Selin_0579    00074 Mycolic acid biosynthesis     Selin_0579   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Selin_0579 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N Ribosomal_L50 MCM_C Motif Other DBs NCBI-ProteinID:  ADU65327 UniProt:  E6W0Z5 LinkDB All DBs Position complement(616854..617084) Genome browser AA seq 76 aa AA seqDB search MSIEQKVKEIVAEQLGVGIDTVNNESSFIDDLGADSLDTVELIMALEEEFGLEIPDDEAE KIVTVQDAISYIENNG NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtccattgagcaaaaagtgaaagaaattgtagcagagcaacttggtgtaggaatcgac acggtaaacaacgagagctctttcattgatgacctgggcgccgacagcctggataccgtg gaactgatcatggccctggaagaagagttcggccttgagattcccgatgacgaagccgaa aaaattgtcaccgtacaggacgccatcagctacatcgaaaacaacggctga

DBGET integrated database retrieval system