Diaphorobacter sp. JS3051: I3K84_06770 Help Entry I3K84_06770       CDS       T11034                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dis  Diaphorobacter sp. JS3051 Pathway dis01100   Metabolic pathways dis01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dis00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I3K84_06770 (acpP)    00074 Mycolic acid biosynthesis     I3K84_06770 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I3K84_06770 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  QPN32303 LinkDB All DBs Position complement(1433236..1433475) Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYANTHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaaaaaaatcattgccgaacaactcggcgtggaagaa tcccaagtcaccaacgaaaaagccttcgtggcagatctgggtgccgactcgctggacacg gtggaactggtgatggcgttggaagacgagttcggcatcgagatccctgacgaagacgca gagaagatcacgacggtgcaaaacgccatcgactacgccaatacccaccagaaggcctaa

DBGET integrated database retrieval system