Dietzia sp. oral taxon 368: C3V38_10845 Help Entry C3V38_10845       CDS       T05390                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism dit  Dietzia sp. oral taxon 368 Brite KEGG Orthology (KO) [BR:dit00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     C3V38_10845 Enzymes [BR:dit01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      C3V38_10845 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Thioredoxin_2 GST_N_2 Glrx-like GST_N Thioredoxin Motif Other DBs NCBI-ProteinID:  AVM64795 UniProt:  A0A2S0LX27 LinkDB All DBs Position complement(2322755..2323024) Genome browser AA seq 89 aa AA seqDB search MSDVTTNDALTLYTTSWCPFCTRLKKLLDEKEIGYAEIDVDADAEAAAFVESVNGGNRVV PTALYSDGTTATNPPASQVRAKLAELAGA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgtgacgaccaacgacgccctgaccctgtacaccacgtcgtggtgcccgttc tgcacgcggctcaagaagctgctggacgagaaggagatcggctacgcggagatcgatgtg gacgccgacgccgaggcggccgcgttcgtcgagagcgtcaacggcggcaaccgggtcgtg ccgaccgccctgtactcggacggcaccacggccaccaacccgccggcctcccaggtgcgc gcgaagctcgccgagctcgcgggcgcctga

DBGET integrated database retrieval system